Artikelilmiahs

Menampilkan 44.381-44.400 dari 48.759 item.
#IdartikelilmiahNIMJudul ArtikelAbstrak (Bhs. Indonesia)Abtrak (Bhs. Inggris) 
  
4438147752H1A021014PERANCANGAN SISTEM ATS PADA SISTEM BATERAI DENGAN SISTEM PROPULSI KERETA KRL KETIKA TERJADI JATUH TEGANGAN SESAAT MENGGUNAKAN MODEL ANFIS
(STUDI KASUS STASIUN CEPER-STASIUN GAWOK)
Seiring dengan perkembangan transportasi kereta api. Kereta Rel Listrik (KRL) menjadi pilihan yang semakin diminati karena dinilai ramah lingkungan. Namun, ketergantungan KRL pada suplai daya gardu traksi sering menimbulkan masalah jatuh tegangan, terutama saat headway kereta terlalu dekat yang dapat mengganggu kinerja dari sistem propulsi. Sebagai solusinya, penelitian ini bertujuan untuk merancang sistem Automatic Transfer Switch (ATS) yang menghubungkan sistem baterai sebagai cadangan tegangan dengan sistem propulsi ketika terjadi jatuh tegangan. Metode yang digunakan dalam penelitian ini adalah Model Adaptive Neuro-Fuzzy Inference System (ANFIS) untuk memberikan logika kontrol otomatis pada saklar ON/OFF ATS. Model ANFIS bekerja dengan membandingkan tegangan sumber dan kecepatan motor untuk memastikan baterai hanya mensuplai saat jatuh tegangan terjadi dibawah ambang batas yaitu 1480 VDC. Pengujian dilakukan dengan dua tahapan yaitu pengujian secara manual dan pengujian dengan ANFIS. Hasil pengujian menunjukkan bahwa sistem ATS yang dikendalikan oleh ANFIS bekerja dengan baik dan memiliki respons yang cepat terhadap kondisi jatuh tegangan. Berdasarkan pengujian, ANFIS mampu membedakan antara penurunan tegangan yang masih dalam batas toleransi dengan penurunan tegangan yang telah melewati ambang batas toleransi (< 1480 VDC), dengan waktu respons kurang dari 0,3 detik dalam pengoperasian otomatis ON/OFF sistem ATS nya.Along with the advancement of railway transportation, Electric Rail Trains (KRL) have become an increasingly popular choice due to their environmental friendliness. However, the reliance of KRL on power supply from traction substations often leads to voltage drops, especially when train headways are too close, which can affect the performance of the propulsion system. To address this issue, this study aims to design an Automatic Transfer Switch (ATS) system that connects a backup battery system to the propulsion system when a voltage drop occurs. The method used in this study is the Adaptive Neuro-Fuzzy Inference System (ANFIS) model to provide automatic control logic for the ATS ON/OFF switch. The ANFIS model works by comparing the source voltage and motor speed to ensure that the battery only supplies power when a voltage drop falls below the threshold of 1480 VDC. Testing is carried out in two stages, namely manual testing and testing with ANFIS. The test results indicate that the ATS system controlled by ANFIS performs effectively and has a fast response to voltage drop conditions. Based on testing, ANFIS can distinguish between voltage drops that are within the allowable tolerance range and those that exceed the threshold (<1480 VDC), with a response time of less than 0.3 seconds in the automatic ON/OFF operation of the ATS system.
4438247755F1B021002Kualitas Pelayanan Publik di Unit Layanan Terpadu (ULT) Kementerian Pendidikan, Kebudayaan, Riset, dan TeknologiUnit Layanan Terpadu (ULT) Kemendikbudristek merupakan lembaga yang dibentuk untuk menyatukan layanan yang ada di dalam Kementerian menjadi kesatuan lebih mudah diakses oleh pemangku kepentingan pendidikan serta masyarakat yang ingin mendapatkan informasi pendidikan, pusat pengaduan, dan pengelolaan beasiswa, serta jenis lainnya. Tujuan penelitian ini untuk mengetahui kualitas pelayanan publik di Unit Layanan Terpadu (ULT) Kemendikbudristek menggunakan teori oleh Zeithaml, Parasuraman, Berry (1988), yang terdiri indikator tangible, reability, responsiviness, assurance, emphaty. Metode penelitian yang digunakan adalah pendekatan kualitatif. Teknik pengumpulan data dilakukan observasi, wawancara, dan dokumentasi. Penelitian menunjukan sudah baik secara keseluruhan, memadai, petugas layanan juga telah menjalankan pelayanan sesuai dengan standar yang ditetapkan. Namun layanan ini masih menemui beberapa kendala yaitu: (1) Dimensi tangible yaitu kerusakan fasilitas layanan yang mengganggu kenyamanan pengguna layanan; (2) Dimensi emphaty yaitu ketidakramahan petugas dalam proses pelayanan.Unit Layanan Terpadu (ULT) Kemendikbudristek is an institution that was formed to unite existing services within the Ministry into a unit that is more easily accessible to education stakeholders and the public who want to obtain educational information, complaint centers, and scholarship management, as well as other types. The aim of this research is to determine the quality of public services in the Unit Layanan Terpadu (ULT) Kemendikbudristek the model by Zeithaml, Parasuraman, Berry (1988), which consists of tangible indicators, reliability, responsiveness, assurance, empathy. The research method used is a qualitative approach. Data collection techniques were carried out using observation, interviews and documentation techniques. Research shows that overall it is good, adequate, service officers have also carried out services in accordance with established standards. However, this service still faces several obstacles, namely: (1) The tangible dimension, namely damage to service facilities which disturbs the comfort of service users; (2) The empathy dimension is the unfriendliness of officers in the service process.
4438347735I1B021070PENGARUH BUTTERFLY HUG THERAPY TERHADAP KECEMASAN SAAT PREMENSTRUAL SYNDROME PADA REMAJA PUTRI Latar Belakang: Kecemasan merupakan keadaan yang ditandai dengan kehilangan kenyamanan. Kecemasan akan mengganggu kerja hipotalamus sehingga akan memengaruhi cara kerja hormon menjadi tidak seimbang dan menyebabkan kadar serotonin di otak menurun. Tindakan pemberian butterfly hug therapy merupakan salah satu terapi non-farmakologi yang dapat digunakan untuk mengurangi kecemasan saat premenstrual syndrome.
Metode: Penelitian ini menggunakan pendekatan kuantitatif dengan quasy experiment pretest and posttest with control group. Jumlah sampel penelitian yaitu 46 responden dengan jumlah masing-masing kelompok yaitu 23 responden yang didapat melalui teknik random sampling. Instrumen yang digunakan adalah Zung Self-Rating Anxiety Scale (ZSAS). Intervensi yang diberikan berupa butterfly hug therapy dengan melakukan sebanyak tiga kali selama tiga hari berturut-turut ketika mengalami kecemasan sedang dengan skor 45-59 saat premenstrual syndrome. Analisis data menggunakan Wilcoxon dan Mann Whitney.
Hasil: Hasil penelitian pada analisis Wilcoxon menunjukkan hasil yaitu terdapat perbedaan yang signifikan skor kecemasan sebelum dan sesudah melakukan butterfly hug therapy pada kelompok intervensi p=0,000 <0,05. Pada analisis Mann Whitney menunjukkan hasil yaitu terdapat perbedaan signifikan skor kecemasan sesudah melakukan butterfly hug therapy antara kelompok intervensi dan kontrol p=0,000 <0,05.
Kesimpulan: Terdapat pengaruh butterfly hug therapy terhadap kecemasan saat premenstrual syndrome
Background: Anxiety was a condition characterized by loss of comfort. Anxiety disrupted the work of the hypothalamus, which affected the way hormones worked, causing an imbalance and decreasing serotonin levels in the brain. Giving butterfly hug therapy was one of the non-pharmacological therapies that could be used to reduce anxiety during premenstrual syndrome.
Methods: This study used a quantitative approach with a quasy experiment pretest and posttest with a control group. The research sample consisted of 46 respondents, with each group comprising 23 respondents, obtained through random sampling. The instrument used was the Zung Self-Rating Anxiety Scale (ZSAS). The intervention given was in the form of butterfly hug therapy, carried out three times for three consecutive days when experiencing moderate anxiety with a score of 45-59 during premenstrual syndrome. The data analysis used the Wilcoxon and Mann Whitney tests.
Results: The results of the Wilcoxon analysis showed that there was a significant difference in anxiety scores before and after the butterfly hug therapy in the intervention group p=0.000 <0.05. The Mann Whitney analysis showed that there was a significant difference in anxiety scores after the butterfly hug therapy between the intervention and control groups p=0.000 <0.05.
Conclusion: There was an effect of butterfly hug therapy on anxiety during premenstrual syndrome.
4438447756C1B021056Analisis Kinerja Investasi pada PT Asuransi Jiwa Taspen menggunakan Metode Sharpe RatioInvestasi merupakan salah satu kegiatan utama pada perusahaan pengelola dana pensiun. Semakin baik kinerja investasi perusahaan pengelola dana pensiun menandakan bahwa perusahaan tersebut mampu mengelola dana peserta dengan baik. PT Asuransi Jiwa Taspen sebagai salah satu perusahaan pengelola dana pensiun di Indonesia perlu melakukan analisis kinerja investasi untuk melihat seberapa baik kinerja investasi PT Asuransi Jiwa Taspen. Metode yang digunakan untuk menganalisis kinerja investasi yaitu menggunakan pengukuran sharpe ratio, dimana hasil kinerja investasi pada PT Asuransi Jiwa Taspen akan dibandingkan dengan kinerja investasi BPJS Ketenagakerjaan. Perbandingan ini dilakukan untuk melihat sejauh mana kinerja investasi PT Asuransi Jiwa Taspen dibandingkan dengan perusahaan pengelola dana pensiun dan asuransi lainnya. Hasil analisis menunjukkan bahwa kinerja investasi PT Asuransi Jiwa Taspen lebih unggul dibandingkan dengan kinerja BPJS Ketenagakerjaan, dimana nilai sharpe ratio pada PT Asuransi Jiwa Taspen sebesar 2,42, sedangkan BPJS Ketenagakerjaan hanya sebesar 2,07. Hal ini disebabkan oleh perbedaan strategi dan komposisi portofolio PT Asuransi Jiwa Taspen dan BPJS Ketenagakerjaan. Meskipun kinerja investasi PT Asuransi Jiwa Taspen lebih unggul, namun kinerja investasi BPJS Ketenagakerjaan masih dapat dikatakan baik karena nilai sharpe ratio lebih dari satu. Diversifikasi portofolio berperan penting dalam menjaga keseimbangan return dan risiko sehingga kinerja investasi pada kedua perusahaan tersebut menghasilkan hasil yang baik.
Kata Kunci: Kinerja Investasi, Sharpe Ratio, Diversifikasi Portofolio, Dana Pensiun, Dana Asuransi
Investment is one of the main activities in pension fund management companies. The better the investment performance of the pension fund management company indicates that the company is able to manage participant funds properly. PT Asuransi Jiwa Taspen as one of the pension fund management companies in Indonesia needs to analyze investment performance to see how well the investment performance of PT Asuransi Jiwa Taspen is. The method used to analyze investment performance uses the sharpe ratio measurement method, where the results of investment performance at PT Asuransi Jiwa Taspen will be compared with the investment performance of BPJS Ketenagakerjaan. This comparison is carried out to see the extent of the investment performance of PT Asuransi Jiwa Taspen compared to other pension and insurance fund management companies. The analysis results show that PT Asuransi Jiwa Taspen's investment performance is superior to the performance of BPJS Ketenagakerjaan, where the sharpe ratio value at PT Asuransi Jiwa Taspen is 2,42, while BPJS Ketenagakerjaan is only 2,07. This is due to the difference between the strategy and portfolio composition of PT Asuransi Jiwa Taspen and BPJS Ketenagakerjan. Although PT Asuransi Jiwa Taspen investment performance is superior, BPJS Ketenagakerjaan investment performance can still be said to be good because the sharpe ratio value is more than one. Portfolio diversification plays an important role in maintaining the balance of return and risk levels so that investment performance in the two companies produces good results.
Keywords: Investment Performance, Sharpe Ratio, Portofolio Diversification, Pension Fund, Insurance Fund
4438547757C1B019089ANALISIS PENGARUH KUALITAS KEHIDUPAN KERJA DAN KOMPENSASI TERHADAP LOYALITAS KARYAWAN
YANG DIMEDIASI OLEH KEPUASAN KERJA
(STUDI KASUS DI PT DATA ENERGI INFOMEDIA PURWOKERTO)
Penelitian ini bertujuan untuk menganalisis pengaruh kualitas kehidupan kerja dan kompensasi terhadap loyalitas karyawan dengan kepuasan kerja sebagai variabel mediasi. Data dikumpulkan melalui kuesioner yang disebarkan kepada karyawan PT Data Energi Infomedia Purwokerto dan dianalisis menggunakan metode analisis regresi dengan pendekatan Structural Equation Modeling Partial Least Squares (PLS-SEM). Hasil penelitian menunjukkan bahwa kualitas kehidupan kerja dan kompensasi tidak berpengaruh secara langsung dengan loyalitas tetapi berpengaruh signifikan terhadap kepuasan kerja, yang pada gilirannya meningkatkan loyalitas karyawan. Kepuasan kerja terbukti sebagai variabel mediasi yang memperkuat hubungan antara kualitas kehidupan kerja serta kompensasi dengan loyalitas karyawan. Temuan ini memberikan implikasi bagi manajemen perusahaan dalam meningkatkan kesejahteraan karyawan guna memperkuat loyalitas merekaThis study aims to analyze the influence of quality of work life and compensation on employee loyalty, with job satisfaction as a mediating variable. Data were collected through questionnaires distributed to employees of PT Data Energi Infomedia Purwokerto and analyzed using regression analysis with the Structural Equation Modeling Partial Least Squares (PLS-SEM) approach. The results indicate that quality of work life and compensation not inpact to loyality but have a significant impact on job satisfaction, which in turn enhances employee loyalty. Furthermore, job satisfaction is proven to be a mediating variable that strengthens the relationship between quality of work life, compensation, and employee loyalty. These findings provide managerial implications for companies in improving employee well-being to foster stronger loyalty.
4438647762C1C021074Pengaruh Financial Distress, Profitabilitas dan Solvabilitas Terhadap Opini Audit Going Concern (Pada Perusahaan Sektor Teknologi yang Terdaftar di Bursa Efek Indonesia Tahun 2020-2023)Penelitian ini menggunakan pendekatan kuantitatif untuk menganalisis pengaruh financial distress, profitabilitas, dan solvabilitas terhadap opini audit going concern yang didasarkan pada teori sinyal. Sampel penelitian terdiri atas 23 perusahaan sektor teknologi yang terdaftar di Bursa Efek Indonesia tahun 2020-2023 yang dipilih dengan teknik purposive sampling. Data yang digunakan dalam penelitian ini adalah data sekunder berupa laporan keuangan tahunan yang telah diaudit. Teknik analisis data yang diterapkan meliputi analisis statistik, uji multikolinearitas, uji statistik analisis regresi logistik, uji Hosmer and Lemeshow’s goodness of fit, uji overall model fit, koefisien determinasi, dan uji hipotesis yang diolah menggunakan perangkat lunak SPSS. Penelitian ini menujukkan bahwa: (1) Financial distress berpengaruh positif terhadap opini audit going concern, yang mengindikasikan bahwa semakin tinggi tingkat financial distress, maka akan semakin besar kemungkinan perusahaan memperoleh opini audit going concern. (2) Profitabilitas berpengaruh negatif terhadap opini audit going concern, yang mengindikasikan bahwa semakin tinggi tingkat profitabilitas, maka akan semakin rendah kemungkinan perusahaan mendapatkan opini audit going concern. (3) Solvabilitas berpengaruh positif terhadap opini audit going concern, yang mengindikasikan bahwa semakin tinggi tingkat solvabilitas, maka semakin besar kemungkinan perusahaan memperoleh opini audit going concern. Implikasi dari penelitian ini memberikan wawasan kepada manajer perusahaan dalam pengambilan keputusan untuk mengurangi risiko opini audit going concern, kepada investor untuk menilai stabilitas keuangan perusahaan dalam pengambilan keputusan investasi, dan kepada auditor untuk meningkatkan akurasi dalam pemberian opini audit going concern.This study is quantitative research with the aim of analyzing the effect of financial distress, profitability, and solvency on the going concern audit opinion, based on signaling theory. The research sample consists of 23 technology sector companies listed on the Indonesia Stock Exchange for the years 2020-2023, selected using purposive sampling. The data used in this study are secondary data in the form of audited annual financial statements. The data analysis techniques applied include statistical analysis, multicollinearity test, statistical test of logistic regression analysis, Hosmer and Lemeshow's goodness of fit test, overall model fit test, coefficient of determination, and hypothesis testing which is processed using SPSS software. The results of the study indicate that: (1) Financial distress has a positive effect on the going concern audit opinion, suggesting that the higher the level of financial distress, the greater the likelihood that the company will receive a going concern audit opinion. (2) Profitability has a negative effect on the going concern audit opinion, indicating that the higher the level of profitability, the lower the likelihood that the company will receive a going concern audit opinion. (3) Solvency has a positive effect on the going concern audit opinion, indicating that the higher the level of solvency, the greater the likelihood that the company will receive a going concern audit opinion. The implications of this research provide insight to company managers in making decisions to reduce the risk of going concern audit opinions, to investors to assess the company's financial stability in making investment decisions, and to auditors to increase accuracy in providing going concern audit opinions.
4438747758C1C019015Deteksi Kecurangan Laporan Keuangan pada Perusahaan Asuransi dengan Pendekatan Fraud Diamond yang Terdaftar di Bursa Efek Indonesia Periode 2019-2022Penelitian ini bertujuan untuk menguji dan menganalisa deteksi kecurangan laporan keuangan pada perusahaan asuransi dengan pendekatan Fraud Diamond yang terdaftar di bursa efek Indonesia periode 2019-2021. Jenis data yang digunakan adalah data sekunder berupa laporan keuangan setiap perusahaan. Jumlah sampel yang digunakan dalam penelitian ini berjumlah 15 sampel penelitian. Teknik pengambilan sampel menggunakan metode purposive sampling berdasrkan kriteria tertentu. Hasil penelitian menggunakan SPSS menunjukkan bahsa: (1) Tekanan berpengaruh terhadap kecurangan laporan keuangan, (2) Rasionalisasi tidak berpengaruh terhadap kecurangan laporan keuangan, (3) Peluang berpengaruh terhadap kecurangan laporan keuangan, (4) Kemampuan tidak berpengaruh terhadap kecurangan laporan keuangan. This research aims to test and analyze the detection of fraudulent financial statements in insurance companies using the Fraud Diamond approach which are listed on the Indonesian stock exchange for the 2019-2021 period. The type of data used is secondary data in the form of financial reports for each company. The number of samples used in this research was 15 research samples. The sampling technique uses a purposive sampling method based on certain criteria. The results of research using SPSS show that: (1) Pressure has an effect on financial report fraud, (2) Rationalization has no effect on financial report fraud, (3) Opportunity has an effect on financial report fraud, (4) Ability has no effect on financial report fraud.
4438847759K1B018065PENERAPAN MODEL PROPORTIONAL ODDS
PADA REGRESI LOGISTIK ORDINAL
(Studi Kasus : Tingkat Keparahan Korban Kecelakaan Lalu Lintas
di Kabupaten Banyumas Tahun 2023)
Kabupaten Banyumas termasuk kabupaten dengan jumlah kecelakaan lalu lintas tertinggi di Provinsi Jawa Tengah. Metode regresi merupakan analisis data yang mendeskripsikan hubungan antara variabel respon dengan satu atau lebih variabel prediktor. Model yang umum digunakan dalam regresi logistik ordinal adalah model proportional odds. Penelitian ini menggunakan data sekunder dari Unit Laka Lantas Polres Banyumas yang terdiri dari tingkat keparahan korban kecelakaan lalu lintas sebagai variabel respon dan lima variabel prediktor. Dalam hal ini variabel responnya dibedakan ke dalam 3 kategori, yaitu korban luka ringan, korban luka berat, dan korban meninggal dunia. Hasil penelitian menunjukkan bahwa terdapat tiga variabel yang berpengaruh terhadap tingkat keparahan korban kecelakaan lalu lintas di Kabupaten Banyumas, yaitu variabel jenis kecelakaan, jenis kendaraan korban, dan waktu kecelakaan.Banyumas Regency is one of the regencies with the highest number of traffic accidents in Central Java Province. The regression method is a data analysis that describes the relationship between the response variable and one or more predictor variables. The model commonly used in ordinal logistic regression is the proportional odds model. This study uses secondary data from the Banyumas Police Traffic Accident Unit, which consists of the severity of traffic accident victims as the response variable and five predictor variables. In this case, the response variables are divided into 3 categories: lightly injured, seriously injured, and deceased. The results of the study indicate that three variables influence the severity of traffic accident victims in Banyumas Regency, namely the variable type of accident, the type of victim vehicle variable, and the variable time of the accident.
4438947760D1A018142PENGARUH UMUR DAN SISTEM PERKANDANGAN TERHADAP KEJADIAN KOKSIDIOSIS PADA TERNAK AYAM BROILER DI KECAMATAN BATURADEN KABUPATEN BANYUMASPenelitian dengan judul pengaruh umur dan sistem perkandangan terhadap kejadian koksidiosis pada ayam broiler di Kecamatan Baturaden Kabupeten Banyumas dilaksanakan pada tanggal 3 Desember 2024 sampai 23 Januari 2025 di Kecamatan Baturaden Kabupaten Banyumas. Tujuan penelitian ini yaitu untuk mengetahui pengaruh umur dan sistem perkandangan yang berbeda terhadap kejadian koksidiosis pada ternak ayam broiler di Kecamatan Baturaden. Materi penelitian yang digunakan berupa 100 sampel feses ayam broiler yang dihitung dengan rumus slovin dengan acuan populasi ternak ayam broiler di Kecamatan Baturaden pada usia starter (0-21 hari) dan finisher (22-35 hari) serta dipelihara dengan sistem closed house dan open house yang berasal dari 6 peternakan di Kecamatan Baturaden, Kabupaten Banyumas. Metode penelitian berupa survei dengan teknik purposive sampling menggunakan kuisioner dan pengambilan sampel feses ayam broiler dengan variabel terikat yang diukur adalah kejadian koksidiosis pada ternak ayam broiler di Kecamatan Baturaden, sedangkan variabel bebas berupa umur ternak dan sistem perkandangan yang digunakan. Data dianalisis menggunakan analisis statistik deskriptif dan regresi logistik dengan memperhatikan kelayakan model regresi menggunakan uji hosmer and lemeshow dan uji psuedo R square. Hasil analisis deskriptif menunjukkan kejadian koksidiosis pada ayam broiler di Kecamatan Baturaden sebesar 71% dan menunjukkan hubungan yang signifikan (Sig<0,05) terhadap umur ternak namun menunjukkan hubungan yang tidak signifikan (Sig>0,05) terhadap sistem perkandangan yang digunakan. Pemeliharaan pada umur awal (starter) dan sistem perkandangan open house dikaitkan dengan peningkatan kejadian koksidiosis pada ayam broiler di Kecamatan Baturaden Kabupaten Banyumas. Research with the tittle Effect of Age and Cage System on infection rate of Broiler Chicken Coccidiosis in Baturaden District, Banyumas Regency was conducted in December 3 2024- January 23 2025 in Baturaden District, Banyumas Regency. The purpose of this research was to determine the effect of age and cage system on broiler chicken coccidiosis in Baturaden District, Banyumas Regency. The material used in this research were 100 faecal sample that determined from using slovin formula using population size of broiler chicken in Baturaden District in starter (age 0-21 day) and finisher (age 22-35 day) phase that kept in closed house and open house system cage as determination, that come from 6 farm in Baturaden District. The research method was survey with purposive sampling using questionnaire and faecal sample taken from broiler chicken. The dependent variable (outcome) determined in this research was infection rate of coccidiosis on broiler chicken in Baturaden District, Banyumas Regency, whereas the independent varible (predictor) were the age and cage system used on broiler chicken farm. Data were then analyze with descriptive analysis and logistic regression with the elygibilty of regression model using hosmer and lemeshow test and pseudo R square test. The result showed that the infection rate of coccidiosis on broiler chicken in Baturaden District were 71% and show significant relation (Sig<0,05) with broiler chicken age, but showed no significant relation (Sig>0,05) with cage system used by broiler chicken farmer. The broiler chicken from starter age and open house cage system contribute in the increasing of coccidiosis rate on broiler chicken in Baturaden District, Banyumas Regency.
4439047761G1A021124UJI AKTIVITAS EKSTRAK KAYU MANIS (Cinnamomum burmannii) SEBAGAI ANTIJAMUR PADA ISOLAT Candida parapsilosis
SECARA IN VITRO

Latar Belakang: Kandidiasis merupakan infeksi jamur oportunistik yang sering terjadi pada negara berkembang. Candida parapsilosis menjadi salah satu penyebab utama kandidiasis non-albicans, yang dapat membentuk biofilm dan resisten terhadap terapi antijamur konvensional. Resistensi antijamur menimbulkan tantangan besar dalam pengobatan infeksi jamur, sehingga diperlukan alternatif dari bahan alami seperti kayu manis (Cinnamomum burmannii).
Tujuan: Penelitian ini bertujuan untuk mengetahui aktivitas ekstrak kayu manis (Cinnamomum burmannii) sebagai antijamur terhadap isolat Candida parapsilosis dengan menentukan Konsentrasi Hambat Minimum (KHM) dan Konsentrasi Bunuh Minimum (KBM). Metode: Penelitian eksperimental ini menggunakan metode mikrodilusi untuk menguji KHM dan KBM pada berbagai konsentrasi ekstrak (0,039%, 0,078%, dan 0,1%) yang dibandingkan dengan kelompok kontrol positif (Ketoconazole), kontrol negatif, dan kontrol pelarut (DMSO 10%). Identifikasi senyawa aktif pada ekstrak kayu manis dilakukan melalui uji Liquid Chromatography High Resolution Mass Spectrometry (LC-HRMS). Hasil: Penelitian menunjukkan bahwa ekstrak kayu manis (Cinnamomum burmannii) mampu mencapai KHM terhadap pertumbuhan C. parapsilosis pada konsentrasi 0,039%. Namun, pada konsentrasi 0,039%, 0,078%, dan 0,1%, ekstrak tidak mencapai KBM, sehingga ekstrak bersifat fungistatik terhadap pertumbuhan jamur C. parapsilosis. Kesimpulan: Ekstrak kayu manis (Cinnamomum burmannii) memiliki potensi sebagai antijamur yang bersifat menghambat (fungistatik) terhadap Candida parapsilosis pada konsentrasi ekstrak yang diujikan dan tidak bersifat membunuh (fungisida).
Background: Candidiasis is an opportunistic fungal infection commonly found in developing countries. Candida parapsilosis is one of the primary causes of non-albicans candidiasis, capable of forming biofilms and developing resistance to conventional antifungal therapies. Antifungal resistance has become a serious issue, necessitating alternatives from natural sources such as cinnamon (Cinnamomum burmannii). Objective: This study aims to evaluate the antifungal activity of cinnamon extract (Cinnamomum burmannii) against Candida parapsilosis isolates by measuring the Minimum Inhibitory Concentration (MIC) and Minimum Fungicidal Concentration (MFC). Methods: This experimental study employed a microdilution method to test the MIC and MFC at various concentrations of the extract (0.039%, 0.078%, and 0.1%), compared to positive control (Ketoconazole), negative control, and solvent control (10% DMSO). Identification of active compounds in the cinnamon extract was conducted through LC-HRMS (Liquid Chromatography High Resolution Mass Spectrometry) testing. Results: The study demonstrated that cinnamon extract (Cinnamomum burmannii) could achieve MIC against the growth of C. parapsilosis at a concentration of 0.039%. However, at concentrations of 0.039%, 0.078%, and 0.1%, the extract did not reach MFC, indicating that the extract exhibits fungistatic properties against the growth of C. parapsilosis. Conclusion: Cinnamon extract (Cinnamomum burmannii) has the potential to act as an antifungal agent that inhibits (fungistatic) Candida parapsilosis at the tested extract concentrations and does not exhibit fungicidal properties. Therefore, further research is needed using higher concentrations to achieve MFC against C. parapsilosis.
4439147795I1B021010Hubungan Aktivitas fisik dengan tekanan darahLatar Belakang : Aktivitas fisik yang kurang merupakan salah satu faktor yang banyak berkontribusi dalam menyebabkan hipertensi pada remaja. Aktivitas fisik yang disarankan untuk remaja yaitu melakukan senam aerobik sedang hingga berat selama 60 menit dalam sehari, aerobik intensitas tinggi, serta aktivitas yang memperkuat otot 3 kali dalam seminggu. Seiring berjalannya waktu, kejadian hipertensi meningkat pada remaja yaitu sekitar 8% dan 12,2% kejadian hipertensi dan prehipertensi pada remaja di Indonesia.
Metode : Penelitian kuantitatif deskriptif analitik kolerasional dengan pendekatan cross sectional yang melibatkan 285 partisipan, dan menggunakan pengambilan sampel dengan teknik stratified random sampling. Data diperoleh menggunakan Physical Activity Quality for Adolescents (PAQ-A) yang diisi menggunakan google form dan pada proses pengambilan data dipantau langsung oleh peneliti, serta pengolahan data diolah menggunakan median dan minimum-maksimum, menggunakan frekuensi dan presentase untuk data aktivitas fisik, dan hubungan antara aktivitas fisik dengan tekanan darah akan dianalisa secara bivariat dengan uji Somer,s D.
Hasil Penelitian : Rata rata partisipan berumur 16 tahun dengan yang termuda 14 tahun dan yang tertua 19 tahun. Mayoritas partisipan berjenis kelamin perempuan (58,6%). Mayoritas partisipan tidak tahu riwayat keluarga hipertensi (80,4). Mayoritas partisipan tidak memiliki riwayat merokok (94,4%). Mayoritas partisipan memiliki indeks massa tubuh normal (53,3%).
Kesimpulan : Terdapat hubungan signifikan antara aktivitas fisik dengan tekanan darah dengan p value = 0,021 (p<0,05) dengan nilai r positif 104.
Kata Kunci : Aktivitas Fisik, Tekanan Darah, Remaja
Background: Lack of physical activity is one of the factors that contribute to hypertension in adolescents. Recommended physical activity for adolescents is doing moderate to vigorous aerobic exercise for 60 minutes a day, high intensity aerobics, and muscle strengthening activities 3 times a week. Over time, the incidence of hypertension has increased in adolescents, which is around 8% and 12.2% of hypertension and prehypertension in adolescents in Indonesia.
Method: Quantitative descriptive analytical correlational research with a cross-sectional approach involving 285 participants, and using sampling with a stratified random sampling technique. Data were obtained using the Physical Activity Quality for Adolescents (PAQ-A) which was filled in using a google form and the data collection process was monitored directly by researchers, and data processing was processed using the median and minimum-maximum, using frequency and percentage for physical activity data, and the relationship between physical activity and blood pressure will be analyzed bivariately with the Somer, s D test.
Research Results: The average age of participants was 16 years with the youngest being 14 years old and the oldest being 19 years old. The majority of participants were female (58.6%). The majority of participants did not know their family history of hypertension (80.4). The majority of participants did not have a history of smoking (94.4%). The majority of participants had a normal body mass index (53.3%).
Conclusion: There is a significant relationship between physical activity and blood pressure with a p value = 0.021 (p <0.05) with a positive r value of 104.
Keywords: Physical Activity, Blood Pressure, Adolescents
4439247764L1C020021Status Pencemaran Logam Berat Hg dan Pengaruh Fraksi Sedimen Serta Bahan Organik Terhadap Konsentrasi Hg pada Sedimen di Sungai Donan, Cilacap
Aktivitas antropogenik seperti pelabuhan niaga, wisata air, dan industri kilang minyak di sekitar perairan Sungai Donan berpotensi menyebabkan pencemaran logam Hg di sedimen yang berbahaya bagi ekosistem. Merkuri (Hg) merupakan logam berat dengan tingkat toksisitas paling tinggi dibandingkan logam lainnya. Penelitian ini bertujuan untuk menganalisis status pencemaran logam Hg di Sungai Donan serta pengaruh fraksi sedimen dan bahan organik terhadap konsentrasi logam Hg di sedimen. Pengambilan sampel sedimen di lakukan di tiga stasiun yang mewakili karakteristik wilayah berbeda. Analisis konsentrasi logam Hg dilakukan menggunakan metode CVAAS. Hasil penelitian konsentrasi rata-rata logam Hg di sedimen Sungai Donan ialah 0,219 mg/kg, dengan konsentrasi tertinggi ditemukan di Stasiun 3 yang merupakan daerah pembuangan limbah industri kilang minyak. Berdasarkan nilai CF dan I-geo sebesar 3,643 dan 1,154, Sungai Donan diindikasikan sebagai tercemar sedang. Analisis korelasi menunjukkan bahwa bahan organik berpengaruh signifikan terhadap konsentrasi logam Hg di sedimen, namun sebaliknya untuk fraksi sedimen.
Kata kunci: Pencemaran laut, merkuri, sedimen, dan bahan organik.
Anthropogenic activities such as commercial ports, water tourism, and the oil refinery industry around the waters of the Donan River have the potential to cause Hg metal pollution in sediments that are harmful for the ecosystem. Mercury (Hg) is one of heavy metal which have the highest toxicity level than another heavy metals. This study aims to analyze the status of Hg metal pollution in the Donan River and the influence of sediment grain size and organic matter on the concentration of Hg metal in sediments. Sediment samples were taken at three stations, which representing different regional characteristics. Analysis of Hg metal concentration was conducted using the CVAAS method. The results of the study showed that the average concentration of Hg metal in the Donan River sediment was 0,219 mg/kg, with the highest concentration found at Station 3 which is an oil refinery industrial waste disposal area. Based on the Cf and I-geo values of 3,643 and 1,154, Donan River is indicated as moderately polluted. Correlation analysis showed that organic matter has a significant effect on the concentration of Hg metal in sediment, otherwise for grain size.
Keywords: Ocean pollution, mercury, sediment, and organic matter.
4439347765I1A018116Faktor-Faktor yang Mempengaruhi Perilaku Minum Obat pada Penderita Tuberkulosis Paru di Klinik Utama Kesehatan Paru Masyarakat (KKPM) Kelas A Kabupaten BanyumasLatar Belakang: Tuberkulosis paru merupakan penyakit menular yang masih menjadi salah satu masalah kesehatan masyarakat di dunia. Pengobatan TB paru yang lama seringkali membuat penderita terkadang merasa jenuh dan tidak teratur minum obat. Tujuan dari penelitian ini yaitu mengetahui faktor-faktor yang mempengaruhi perilaku minum obat penderita TB Paru di KKPM Kabupaten Banyumas.
Metode: Penelitian ini merupakan penelitian kuantitatif dengan pendekatan cross-sectional. Sampel penelitian ini sebanyak 94 penderita TB paru di KKPM Kabupaten Banyumas dengan teknik pengambilan sampel menggunakan insidental sampling. Variabel yang diteliti meliputi meliputi usia, jenis kelamin, pendidikan, status pekerjaan, pengetahuan, sikap, efek samping OAT, akses fasilitas kesehatan, dukungan keluarga, peran PMO, dan peran petugas kesehatan. Instrumen yangdigunakan yaitu wawancara dengan kuesioner. Analisis data meliputi analisis univariat, bivariat, dan multivariat.
Hasil Penelitian: Hasil penelitian menunjukkan jenis kelamin (p=0,007), pengetahuan (p=0,008), peran PMO (0,026), dan peran petugas kesehatan (p=0,011) berhubungan dengan perilaku minum obat pada penderita TB paru di KKPM Kabupaten Banyumas. Faktor yang paling berpengaruh adalah pengetahuan (p=0,002; POR=4,792) artinya pengetahuan kurang baik memiliki risiko 4,794 kali lebih besar untuk memiliki perilaku minum obat yang kurang baik dibandingkan dengan responden dengan pengetahuan baik.
Kesimpulan: Terdapat hubungan antara jenis kelamin, pengetahuan, peran PMO dan peran petugas kesehatan terhadap perilaku minum obat pada penderita TB paru di KKPM Kabupaten Banyumas. Pengetahuan merupakan faktor yang paling berpengaruh. Saran bagi penderita TB paru sebaiknya lebih sering mencari informasi mengenai pengobatan TB paru dan meningkatkan kesadaran diri untuk minum obat teratur.
Background: Pulmonary tuberculosis is an infectious disease that remains one of the public health issues in the world. Long-term treatment for pulmonary tuberculosis often makes patients feel bored and don't take medication regularly. The purpose of this study is to identify the factors that influence the medication-taking behavior of pulmonary TB patients at KKPM Banyumas.
Methods: This research is a quantitative study with a cross-sectional approach. The sample for this study consisted of 94 pulmonary TB patients at KKPM Banyumas Regency, using incidental sampling technique. The variables studied include age, gender, education, employment status, knowledge, attitude, side effects of anti-TB drugs, access to health facilities, family support, the role of treatment supervisor, and the role of health workers. The instrument used was interviews with questionnaires. Data analysis includes univariate, bivariate, and multivariate analysis.
Research Results: The results show that gender (p=0.007), knowledge (p=0.008), the role of treatment supervisor (0.026), and the role of health workers (p=0.011) were related to medication taking behavior of pulmonary TB patients at KKPM Banyumas. The most influential factor is knowledge (p=0.002; POR=4.792), meaning that poor knowledge has a 4.794 times greater risk of having poor medication taking behavior compared to respondents with good knowledge.
Conclusion: There is a relationship between gender, knowledge, role of PMO and role of health workers on medication-taking behavior in patients with pulmonary TB in KKPM Banyumas Regency. Knowledge is the most influential factor. Suggestions for patients with pulmonary TB should seek information more often about pulmonary TB treatment and increase self-awareness to take medication regularly.
4439447766B1A021043PENGARUH PENGAYAAN MIKRO-DEKOMPOSER C631 TERHADAP JALUR DEKOMPOSISI FUNGI DI LAHAN PERTANIAN DESA GANDATAPA, KABUPATEN BANYUMASTanah pada umumnya memiliki dua jalur dekomposisi yaitu jalur bakteri dan fungi. Tanah agroekosistem konvensional cenderung didominasi oleh bakteri, sebagai pengaruh penggunaan pupuk sintetis, fungisida sintetis, praktik pembajakan tanah, dan rendahnya kandungan materi organik C:N rasio tinggi yang berpotensi menurunkan kesehatan tanah. Dengan peran fungi sebagai dekomposer dengan turn over lebih lama dari pada bakteri, maka diperlukan peningkatan jalur dekomposisi fungi melalui aplikasi C631 dan pengayaan substansi humat serta kelp. Tujuan dari penelitian ini adalah mengetahui perubahan kelimpahan fungi dan nematoda tanah (pertanian) sebagai akibat aplikasi komunitas jejaring mikro-dekomposer C631, dan mengetahui respon jalur dekomposisi fungi terhadap pengayaan substansi humat dan kelp pada tanah pertanian yang telah memperoleh aplikasi jejaring mikro-dekomposer C631.
Penelitian ini menggunakan metode eksperimental dengan Rancangan Acak Lengkap (RAL) dan empat perlakuan: tanah tanpa C631 dan tanpa pengayaan, tanah dengan aplikasi C631, tanah dengan aplikasi C631 diperkaya substansi humat, dan tanah dengan aplikasi C631 diperkaya kelp. Parameter yang diamati meliputi kelimpahan fungi, komunitas nematoda, dan sifat fisik-kimia tanah. Data dianalisis menggunakan Permutation Multivariate Analysis of Variance untuk menguji signifikan antar perlakuan. Indeks food web digunakan untuk mengevaluasi kontribusi jalur dekomposisi fungi, sedangkan Canonical Correspondence Analysis digunakan untuk mengamati korelasi kelimpahan fungi dan komunitas nematoda dengan parameter fisik serta kimia berdasarkan perlakuan yang diberikan
Hasil penelitian menunjukkan bahwa aplikasi C631 secara signifikan meningkatkan kelimpahan fungi. Fungi tidak terdeteksi pada tanah sebelum perlakuan, sedangkan setelahnya kelimpahan fungi mencapai 8,71 × 10⁵ µm³/g pada tanah tanpa pengayaan, 1,51 × 10⁶ µm³/g pada tanah dengan aplikasi C631, dan tertinggi sebesar 2,29 × 10⁶ µm³/g pada perlakuan yang diperkaya substansi humat. Hasil enumerasi nematoda mengungkapkan bahwa meskipun total individu nematoda menurun setelah perlakuan, terjadi pergeseran struktur komunitas dengan peningkatan kelompok fungivora, yang mengindikasikan bahwa peningkatan fungi memberikan sumber nutrisi bagi nematoda. Analisis indeks food web menunjukkan bahwa nilai Channel Index (CI) lebih tinggi pada perlakuan C631 dengan pengayaan humat (CI: 34,20) dibandingkan dengan tanah tanpa pengayaan (CI: 9,80) dan perlakuan dengan pengayaan kelp (CI: 9,80), mengindikasikan kehadiran jalur dekomposisi fungi. Dengan demikian, hasil penelitian ini mendukung hipotesis bahwa aplikasi komunitas jejaring mikro-dekomposer C631, terutama yang diperkaya dengan substansi humat, mampu meningkatan kelimpahan fungi dan mengubah struktur komunitas nematoda, yang secara kolektif mengarah pada peningkatan jalur dekomposisi fungi. Hasil ini memberikan dasar bagi pengembangan sistem pengelolaan tanah yang lebih berkelanjutan melalui optimasi jalur dekomposisi dan peningkatan kesehatan tanah.
Soil generally exhibit two decomposition pathways bacterial and fungal. Conventional agroecosystems tend to be dominated by bacteria, a condition attributed to the use of synthetic fertilizers and fungicides, conventional tillage practices, and low organic matter content with high C:N ratios, all of which may compromise soil health. Given that fungi, as decomposers, have a longer turnover period than bacteria, it is necessary to enhance the fungal decomposition pathway through the application of C631 and enrichment with humate and kelp. The objectives of this study were to determine changes in the abundance of soil fungi and nematodes (in agricultural soils) as a result of applying the C631 micro-decomposer community, and to assess the response of the fungal decomposition pathway to enrichment with humate and kelp in soils treated with C631.
An experimental method using a Completely Randomized Design (CRD) was employed with four treatments: (1) soil without C631 and without enrichment, (2) soil with the application of C631, (3) soil with C631 enriched with humate, and (4) soil with C631 enriched with kelp. The parameters observed included fungal abundance, nematode community composition, and the physicochemical properties of the soil. Data were analyzed using Permutation Multivariate Analysis of Variance to test for significant differences among treatments. Food web indices were used to evaluate the contribution of the fungal decomposition pathway, while Canonical Correspondence Analysis was employed to assess the correlations between the abundance of fungi and the nematode community with the soil’s physical and chemical parameters according to the given treatments.
The results indicate that the application of C631 significantly increased fungal abundance. Fungi were not detected in the soil prior to treatment; however, after treatment, fungal abundance reached 8.71 × 10⁵ µm³/g in soil without enrichment, 1.51 × 10⁶ µm³/g in soil with C631, and peaked at 2.29 × 10⁶ µm³/g in the treatment enriched with humate. Nematode enumeration revealed that although the total number of nematodes decreased following treatment, there was a shift in the community structure with an increase in fungivorous groups, suggesting that the increased fungal population provided an additional nutrient source for nematodes. Analysis of the food web indices showed that the Channel Index (CI) was higher in the C631 treatment enriched with humate (CI: 34.20) compared to both the soil without enrichment (CI: 9.80) and the treatment with kelp enrichment (CI: 9.80), indicating the presence of a fungal decomposition pathway. Thus, the results of this study support the hypothesis that the application of the C631 micro-decomposer community, particularly when enriched with humate, can increase fungal abundance and alter the nematode community structure, collectively leading to an enhanced fungal decomposition pathway. These findings provide a foundation for developing more sustainable soil management systems by optimizing decomposition pathways and improving soil health.
4439547763B1A019102DIVERSITAS TUMBUHAN PADA HUTAN HOMOGEN DAN HETEROGEN DI GUNUNG SLAMET WILAYAH
KPH BANYUMAS TIMUR
Kawasan hutan hujan teropis di Gunung Slamet yang terletak pada kawasan KPH Banyumas Timur termasuk kedalam hutan lindung. Dari hasil survei awal yang dilaksanakan terdapat perbedaan spesies vegetasi tumbuhan pada kawasan hutan jalur pendakian Baturraden Baru, lereng selatan Gunung Slamet. Penelitian ini bertujuan untuk mengetahui diversitas tumbuhan pada hutan homogen dan heterogen serta mengetahui spesies tumbuhan yang mendominasi di hutan homogen dan heterogen di Gunung Slamet wilayah KPH Banyumas Timur. Penelitian ini dilakukan di Jalur Pendakian Baturraden Baru Gunung Slamet menggunakan metode survei dengan teknik jalur berpetak pada hutan homogen dan heterogen. Data yang dianalisis menggunakan Indeks Diversitas (H’) dan Indeks Nilai Penting Shannon-Wiener menggunakan Ms. Excel. Hasil penelitian menunjukan Indeks Diversitas (H’) tertinggi didapatkan pada hutan heterogen dengan nilai 1,7 sedangkan nilai terendah pada hutan homogen dengan nilai 0,81. Jumlah spesies pada kategori pohon diperoleh 11 spesies tumbuhan yang berasal dari famili Apocynaceae, Arecaceae, Araucariaceae, Euphorbiaceae, Moraceae, Myrtaceae, Pandanaceae, Pinaceae, dan Theaceae ditemukan. Pada kategori tiang ditemukan 10 spesies tumbuhan yang berasal dari famili Arecaceae, Araucariaceae, Euphorbiaceae, Musaceae, Moraceae, Myrtaceae, Pinaceae, dan Theaceae. Pada kategori pancang ditemukan 8 spesies tumbuhan yang berasal dari famili Arecaceae, Araucariaceae, Fabaceae, Gesneriaceae, Moraceae, Primulaceae, dan Theaceae. Sedangkan pada kategori semai ditemukan 13 spesies tumbuhan dari famili Arecaceae, Araceae, Araucariaceae, Begoniaceae, Dennstaedtiaceae, Fabaceae, Costaceae, Gesneriaceae, Melastomataceae, Rosaceae, dan Selaginellaceae. Hasil dari penelitian juga menunjukan tidak adanya spesies tumbuhan yang mendominasi pada hutan heterogen namun pada hutan homogen spesies Agathis alba mendominasi


Tropical rainforest area on Mount Slamet, located at the KPH Banyumas Timur area, is classified as a protected forest, which belongs to the tropical rainforest group. From the initial survey conducted, there were differences in plant vegetation species in the forest area of the New Baturraden hiking trail, on the southern slope of Mount Slamet. This study aims to determine the diversity of plants in homogeneous and heterogeneous forests and to determine the plant species that dominate in homogeneous and heterogeneous forests on Mount Slamet in the East Banyumas KPH area. This research was conducted on the New Baturraden Hiking Trail of Mount Slamet using a survey method with a plot line technique in homogeneous and heterogeneous forests. The data were analyzed using the Diversity Index (H') and the Shannon-Wiener Importance Value Index using Ms. Excel.
The research results showed that the highest Diversity Index (H') was found in the heterogeneous forest with a value of 1.7, while the lowest value was found in the homogeneous forest with a value of 0.81. A total of 11 plant species were obtained in the tree category, belonging to the families Apocynaceae, Arecaceae, Araucariaceae, Euphorbiaceae, Moraceae, Myrtaceae, Pandanaceae, Pinaceae, and Theaceae. In the pole category, 10 plant species were found, belonging to the families Arecaceae, Araucariaceae, Euphorbiaceae, Musaceae, Moraceae, Myrtaceae, Pinaceae, and Theaceae. In the sapling category, 8 plant species were found, belonging to the families Arecaceae, Araucariaceae, Fabaceae, Gesneriaceae, Moraceae, Primulaceae, and Theaceae. Meanwhile, in the seedling category, 13 plant species were found from the families Arecaceae, Araceae, Araucariaceae, Begoniaceae, Dennstaedtiaceae, Fabaceae, Costaceae, Gesneriaceae, Melastomataceae, Rosaceae, and Selaginellaceae. The results of the research also show that there are no plant species that dominate in heterogeneous forests, but in homogeneous forests, the Agathis alba species dominate.
4439647767K1A020053IDENTIFIKASI DAN PENAMBATAN MOLEKUL PEPTIDA DARI FRAKSI HIDROLISAT PROTEIN SUSU KEDELAI TERHADAP RESEPTOR BAKTERI Escherichia coliResistensi obat merupakan salah satu ancaman kesehatan terbesar di abad ke-21 yang salah satunya Antimicrobial Resistance (AMR). Penggunaan antibiotik secara terus menerus dapat menurunkan mortalitas dan morbiditas pada pasien, sehingga perlu adanya eksplorasi antibiotik dari sumber bahan alam. Kedelai merupakan sumber protein yang dapat menghasilkan peptida bioaktif melalui hidrolisis enzimatis dengan enzim tripsin dan memiliki sifat sebagai peptida antibakteri terhadap E. coli. Penelitian ini bertujuan untuk mengidentifikasi urutan sekuen peptida dan memprediksi interaksi peptida fraksi hidrolisat susu kedelai dengan reseptor GyrB, PBP1b, dan PDF pada bakteri E. coli secara penambatan molekul. Penelitian ini dilakukan beberapa tahap yaitu hidrolisis, fraksinasi, analisis LC-HRMS dan penambatan molekul dengan HADDOCK 2.4. Fraksi peptida hasil hidrolisat menghasilkan kadar 35,857 ppm. Hasil penelitian menunjukkan bahwa urutan asam amino peptida yang dihasilkan yaitu IITSLGVK (P1) dan AKEMHIDAANTREYSIDHQSSNMDSDVAASHIDTV (P2). Hasil penambatan molekul peptida menunjukkan bahwa P1 membentuk pengikatan yang paling stabil dan spesifik dengan reseptor PBP1b dengan afinitas ikatan -11,0 kkal/mol dan membentuk interaksi spesifik pada residu asam amino Asn574, Asn703, Ala613, Ser507, Gly612, Ala608, Trp548, dan Asn615 sebagai ikatan hidrogen serta pada asam amino Lys553, Thr702, Ser510, Gln551, Pro550, Leu611, Thr701, Ser549, Gly509, dan Val706 sebagai interaksi hidrofobik. Adapun P2 membentuk pengikatan yang paling stabil dan spesifik dengan reseptor PDF dengan afinitas ikatan -9,4 kkal/mol dan membentuk interaksi spesifik pada residu asam amino Glu87, Glu95, Arg97, Glu41, Asp123, Leu125, dan Lys165 sebagai ikatan hidrogen serta Ile86, Ile44, Gly43, Glu42, Gly89, Cys90, Glu88, Leu91, Glu64, Ile128, Val62, Arg66, Asp162, dan Leu164 sebagai interaksi hidrofobik.Drug resistance is one of the biggest health threats in the 21st century, one of which is Antimicrobial Resistance (AMR). Continuous use of antibiotics can reduce mortality and morbidity in patients, so it is necessary to explore antibiotics from natural sources. Soybeans are a source of protein that can produce bioactive peptides through enzymatic hydrolysis with the enzyme trypsin and have properties as antibacterial peptides against E. coli. . This study aims to identify peptide sequences and predict the interaction of soy milk hydrolysate fraction peptides with GyrB, PBP1b, and PDF receptors in E. coli bacteria by molecular docking. This research was carried out in several stages, namely hydrolysis, fractionation, LC-HRMS analysis and molecular docking with HADDOCK 2.4. The results showed that the amino acid sequences of the peptides produced were IITSLGVK (P1) and AKEMHIDAANTREYSIDHQSSNMDSDVAASHIDTV (P2). The peptide molecule docking results show that P1 forms the most stable and specific binding with the PBP1b receptor with a binding affinity of -11.0 kcal/mol and forms specific interactions at amino acid residues Asn574, Asn703, Ala613, Ser507, Gly612, Ala608, Trp548, and Asn615 as a hydrogen bond as well as to the amino acids Lys553, Thr702, Ser510, Gln551, Pro550, Leu611, Thr701, Ser549, Gly509, and Val706 as hydrophobic interactions. Meanwhile, P2 forms the most stable and specific binding with the PDF receptor with a binding affinity of -9.4 kcal/mol and forms specific interactions at the amino acid residues Glu87, Glu95, Arg97, Glu41, Asp123, Leu125, and Lys165 as hydrogen bonds and Ile86, Ile44, Gly43, Glu42, Gly89, Cys90, Glu88, Leu91, Glu64, Ile128, Val62, Arg66, Asp162, and Leu164 as hydrophobic interactions.
4439747768H1D021004PERBANDINGAN PERFORMA DAN OPTIMALISASI SEO ANTARA LARAVEL BLADE DAN LARAVEL INERTIA DALAM PENGEMBANGAN WEBSITE INFORMASI JALUR PENDAKIAN GUNUNG DI INDONESIA MUNCAK.IDMendaki gunung di Indonesia memerlukan persiapan matang, terutama dalam memahami jalur pendakian yang aman dan informasi terkait lainnya. Website informasi jalur pendakian menjadi solusi praktis bagi para pendaki untuk mengakses data secara mudah dan cepat. Penelitian ini membandingkan performa dan optimalisasi SEO antara Laravel Blade dan Laravel Inertia dalam pengembangan website muncak.id, yang menyediakan informasi jalur pendakian gunung. Indikator performa yang diuji adalah waktu eksekusi pengujian yang diuji menggunakan Laravel Dusk. Salah satu hasil pengujian pada fitur akses jalur pendakian menunjukkan bahwa Laravel Inertia Vue.js memiliki rata-rata waktu eksekusi 1,56 detik, yang lebih cepat dibandingkan dengan Laravel Blade yang mencapai 3,89 detik. Dalam hal SEO, kedua website menunjukkan kualitas yang baik dengan tidak ditemukannya masalah bertipe issue. Namun, masih terdapat peluang untuk perbaikan pada beberapa aspek masalah bertipe warning dan opportunity. Secara keseluruhan, Laravel Inertia dengan Vue.js terbukti lebih unggul dalam hal performa dan konsistensi, sekaligus lebih efektif dalam pengoptimalan SEO, menjadikannya pilihan yang lebih baik untuk pengembangan website informatif.Climbing mountains in Indonesia requires careful preparation, especially in understanding safe hiking routes and related information. A hiking route information website serves as a practical solution for hikers to access data easily and quickly. This study compares the performance and SEO optimization between Laravel Blade and Laravel Inertia in the development of the muncak.id website, which provides information on mountain hiking routes. The performance indicator tested is execution time, measured using Laravel Dusk. One of the test results for the hiking route access feature shows that Laravel Inertia Vue.js has an average execution time of 1.56 seconds, which is faster compared to Laravel Blade, which reached 3.89 seconds. In terms of SEO, both websites show good quality with no issues found. However, there are still opportunities for improvement in some areas marked as warnings and opportunities. Overall, Laravel Inertia with Vue.js proves superior in performance and consistency, as well as more effective in SEO optimization, making it the better choice for developing informative websites.
4439847769K1A020071PENGARUH VARIASI TEKANAN NOZZLE DAN PERBANDINGAN BAHAN PENGISI TERHADAP KARAKTERISTIK TEH HIJAU INSTAN HASIL SPRAY DRYER SEBAGAI ANTIOKSIDANTeh hijau banyak dikonsumsi dalam bentuk teh celup, namun kantong teh celup mengandung klorin yang berisiko pada kesehatan. Alternatif yang dapat dilakukan adalah dengan membuat teh hijau instan bebas dari kontaminasi klorin. Serbuk teh hijau diproduksi dengan menggunakan teknologi spray dryer dengan ditambahkan filler pada ekstrak teh. Pada penelitian ini, dilakukan optimasi untuk mengetahui pengaruh filler terhadap ekstrak, maltodekstrin terhadap filler, dan tekanan nozzle terhadap kelarutan, aktivitas antioksidan, dan kadar epigalokatekin galat (EGCG) terbaik pada proses pembuatan teh hijau instan dengan spray dryer. Optimasi dilakukan dengan menggunakan pendekatan Response Surface Methodology (RSM) metode Box Behnken Design dengan filler dalam ekstrak sebesar 5%; 10% dan 15%, maltodekstrin dalam filler sebesar 20%; 35%; dan 50% , dan tekanan nozzle sebesar 0,10 MPa; 0,14 MPa; dan 0,18 MPa. Pengujian kelarutan teh hijau instan dilakukan dengan metode gravimetri sedangkan aktivitas antioksidan menggunakan metode 1,1-diphenyl-2-picrylhydrazyl (DPPH), dan pengukuran kadar EGCG menggunakan high performance liquid chromatography (HPLC). Berdasarkan penelitian, kelarutan serbuk teh instan hasil spray dryer dipengaruhi oleh penambahan maltodekstrin dalam filler dan tekanan nozzle, di mana peningkatan keduanya meningkatkan kelarutan. Aktivitas antioksidan serbuk teh instan hasil spray dryer dipengaruhi oleh filler dalam ekstrak, yang umumnya menurunkan aktivitas antioksidan. Penambahan maltodekstrin meningkatkan aktivitas antioksidan, namun pada level tertentu efeknya menurun, sementara tekanan nozzle yang tinggi cenderung meningkatkan aktivitas antioksidan. Kadar EGCG serbuk teh instan hasil spray dryer dipengaruhi oleh filler dalam ekstrak, maltodekstrin dalam filler, dan tekanan nozzle di mana peningkatan ketiganya menurunkan kadar EGCG. Kondisi optimal untuk mendapatkan hasil optimal pada proses pembuatan teh hijau instan menggunakan RSM adalah dengan filler dalam
ekstrak 5%, maltodesktrin dalam ekstrak 30,82%, dan tekanan nozzle 0,134 MPa dengan nilai estimasi kelarutan 80,54%, persen penghambatan dari aktivitas antioksidan sebesar 63,38% dan kadar EGCG sebesar 0,13 mg/mg.
Green tea is widely consumed in the form of teabags, but teabags contain chlorine which poses a health risk. An alternative is to make instant green tea free from chlorine contamination. Green tea powder is produced using spray dryer technology by adding filler to the tea extract. In this study, optimisation was carried out to determine the effect of filler on extract, maltodextrin on filler, and nozzle pressure on solubility, antioxidant activity, and the best epigalocatechin gallate (EGCG) levels in the process of making instant green tea with a spray dryer. Optimisation was conducted using Response Surface Methodology (RSM) approach of Box Behnken Design method with 5%, 10% and 15% filler in extract, 20%, 35% and 50% maltodextrin in filler, and 0.10 MPa, 0.14 MPa and 0.18 MPa nozzle pressure. Testing the solubility of instant green tea was done by gravimetric method while antioxidant activity used 1,1-diphenyl-2-picrylhydrazyl (DPPH) method, and measurement of EGCG content using high performance liquid chromatography (HPLC). Based on the study, the solubility of spray-dried instant tea powder was affected by the addition of maltodextrin in the filler and nozzle pressure, where a increase in both increased the solubility. The antioxidant activity of spray-dried instant tea powder was affected by the filler in the extract, which generally decreased the antioxidant activity. The addition of maltodextrin increased the antioxidant activity, but at certain levels the effect decreased, while high nozzle pressure tended to increase the antioxidant activity. The EGCG content of spray dried instant tea powder was influenced by filler in the extract, maltodextrin in the
filler, and nozzle pressure where increasing all three decreased the EGCG content. The optimal condition to obtain optimal results in the process of making instant green tea using RSM is with 5% filler in extract, 30.82% maltodextrin in extract, and 0.134 MPa nozzle pressure with an estimated solubility value of 80.54%, percent inhibition of antioxidant activity of 63.38% and EGCG levels of 0.13 mg/mg.
4439947770I1B021036HUBUNGAN PARTISIPASI AYAH DALAM PEMBERIAN
MPASI DENGAN STATUS GIZI BAYI 6–12 BULAN
DI DESA GANDATAPA
Latar belakang: Pemberian makanan pendamping ASI (MPASI) yang tepat merupakan faktor penting dalam mendukung tumbuh kembang bayi terutama dalam menentukan status gizi bayi. Keterlibatan ayah dalam pemberian MPASI dapat berkontribusi terhadap status gizi bayi, tetapi masih banyak ayah yang kurang berpartisipasi dalam proses ini. Penelitian ini bertujuan untuk menganalisis hubungan antara partisipasi ayah dalam pemberian MPASI dengan status gizi bayi usia 6–12 bulan di Desa Gandatapa.
Metodologi: Penelitian ini menggunakan metode analisis korelasi kuantitatif dengan desain cross-sectional. Populasi dalam penelitian ini adalah ayah yang memiliki bayi berusia 6–12 bulan di Desa Gandatapa, dengan teknik total sampling sebanyak 44 responden. Data dikumpulkan menggunakan kuesioner untuk mengukur partisipasi ayah yaitu Early Childhood Longitudinal Study-Birth Cohort dan pengukuran status gizi bayi berdasarkan indikator Berat Badan menurut Umur (BB/U). Analisis data dilakukan secara univariat dan bivariat menggunakan uji Somers’ D.

Hasil penelitian: karakteristik ayah dengan nilai tengah usia yaitu 33 tahun dengan tingkat pendidikan mayoritas SMA, bekerja sebagai buruh dan pendapatan <UMR Banyumas tahun 2024. Partisipasi ayah mayoritas tergolong cukup dengan status gizi mayoritas normal. Analisis uji Somers’d diperoleh hasil p-value = 0.292 (p>0.05) yang menunjukkan tidak terdapat hubungan yang signifikan antara partisipasi ayah dalam pemberian MPASI dengan status gizi bayi usia 6–12 bulan di Desa Gandatapa.
Kesimpulan: tidak terdapat hubungan yang signifikan antara partisipasi ayah dalam pemberian MPASI dengan status gizi bayi usia 6 – 12 bulan di Desa Gandatapa.
Background: Appropriate complementary feeding (MPASI) is a crucial factor in supporting infant growth and development, particularly in determining nutritional status. Father's involvement in complementary feeding may contribute to the nutritional status of infants; however, many fathers still have low participation in this process. This study aims to analyze the relationship between fathers' participation in complementary feeding and the nutritional status of infants aged 6–12 months in Gandatapa Village.
Methodology: This study employed a quantitative correlation analysis method with a cross-sectional design. The population consisted of fathers with infants aged 6–12 months in Gandatapa Village, with a total sampling technique involving 44 respondents. Data were collected using a questionnaire to measure fathers' participation based on the Early Childhood Longitudinal Study-Birth Cohort and the measurement of infant nutritional status using the Weight-for-Age (W/A) indicator. Data analysis was conducted using univariate and bivariate analysis with the Somers' D test.
Results: The median age of fathers was 33 years, with the majority having a high school education, working as laborers, and earning below the minimum wage of Banyumas in 2024. Most fathers had a moderate level of participation, and the majority of infants had a normal nutritional status. The Somers' D test analysis resulted in a p-value of 0.292 (p>0.05), indicating no significant relationship between fathers' participation in complementary feeding and the nutritional status of infants aged 6–12 months in Gandatapa Village.
Conclusion: There is no significant relationship between fathers' participation in complementary feeding and the nutritional status of infants aged 6–12 months in Gandatapa Village.
4440047745I1B021057HUBUNGAN USIA, LAMA MENDERITA DAN TINGKAT KECEMASAN DENGAN KADAR GLUKOSA DARAH SEWAKTU PADA PASIEN DIABETES MELITUS DI WILAYAH PUSKESMAS CIPARILatar belakang : Diabetes melitus (DM) merupakan penyakit metabolik kronis yang ditandai dengan hiperglikemia akibat gangguan sekresi insulin, kerja insulin, atau keduanya. Kadar glukosa darah sewaktu pada penderita DM dipengaruhi berbagai faktor. Penelitian ini bertujuan untuk menganalisis hubungan antara usia, lama menderita DM dan tingkat kecemasan dengan kadar glukosa darah sewaktu pada pasien DM di wilayah Puskesmas Cipari.

Metodologi : Penelitian ini menggunakan metode korelasi analitik kuantitatif pendekatan cross-sectional. Teknik sampling menggunakan purposive sampling pada 63 responden. Instrumen penelitian menggunakan kuesioner karakteristik responden, kuesioner Zung Self-rating Anxiety Scale (ZSAS) dan glukometer. Analisis data menggunakan analisis univariat deksriptif dan bivariat dengan uji Spearman rank serta multivariat dengan korelasi regresi linear berganda.

Hasil penelitian : Hasil rata-rata usia responden 60,76 tahun. Mayoritas berjenis kelamin perempuan. Sebagian besar berpendidikan terakhir SD. Sebanyak 35 responden menderita DM ≥ 5 tahun. Mayoritas responden mengalami kecemasan sedang (54,0%) dan rata-rata kadar glukosa darah sewaktu 239,20 mg/dL. Terdapat hubungan yang signifikan antara usia dengan kadar glukosa darah sewaktu (p = 0,033, r = 0,270). Terdapat hubungan yang signifikan antara lama menderita dengan kadar glukosa darah sewaktu (p = 0,001, r = 0,476). Terdapat hubungan yang signifikan antara tingkat kecemasan dengan kadar glukosa darah sewaktu (p = 0,0001, r = 0,497). Terdapat hubungan antara usia, lama menderita dan tingkat kecemasan dengan kadar glukosa darah sewaktu (Ryx1x2x3 = 0,610) dan persamaan regresi Y= 51,469 + 1,928X1 – 34,514X2 + 47,509X3.

Kesimpulan : Terdapat hubungan antara usia, lama menderita DM dan tingkat kecemasan dengan kadar glukosa darah sewaktu pada pasien DM.



Background: Diabetes mellitus (DM) is a chronic metabolic disease characterized by hyperglycemia due to impaired insulin secretion, insulin action, or both. Random blood glucose levels in DM patients are influenced by various factors. This study aims to analyze the relationship between age, duration of DM, and anxiety levels with random blood glucose levels in DM patients at the Cipari Public Health Center.
Methodology: This study used a quantitative analytical correlation method with a cross-sectional approach. A purposive sampling technique was applied to 63 respondents. Research instruments included a respondent characteristic questionnaire, Zung Self-rating Anxiety Scale (ZSAS), and glucometer. Data were analyzed using univariate descriptive analysis, bivariate analysis with the Spearman rank test and multivariate with multiple linear regression correlation.
Results: The average age of respondents was 60.76 years, with the majority female and having a primary school education. A total of 35 respondents had suffered from DM for ≥ 5 years. Most respondents experienced moderate anxiety (54.0%), and the average random blood glucose level was 239.20 mg/dL. There was significant relationship between age and random blood glucose (p = 0.033, r = 0.270), duration of DM and random blood glucose (p = 0.001, r = 0.476), and anxiety levels and random blood glucose (p = 0.0001, r = 0.497). A combined relationship was found (Ryx1x2x3 = 0.610), with the regression equation Y = 51.469 + 1.928X1 – 34.514X2 + 47.509X3.
Conclusion: There is a relationship between age, duration , and anxiety levels with random blood glucose levels in DM patients.