| NIM | K1A020053 |
| Namamhs | SANDRA NOVITASARI |
| Judul Artikel | IDENTIFIKASI DAN PENAMBATAN MOLEKUL PEPTIDA DARI FRAKSI HIDROLISAT PROTEIN SUSU KEDELAI TERHADAP RESEPTOR BAKTERI Escherichia coli |
| Abstrak (Bhs. Indonesia) | Resistensi obat merupakan salah satu ancaman kesehatan terbesar di abad ke-21 yang salah satunya Antimicrobial Resistance (AMR). Penggunaan antibiotik secara terus menerus dapat menurunkan mortalitas dan morbiditas pada pasien, sehingga perlu adanya eksplorasi antibiotik dari sumber bahan alam. Kedelai merupakan sumber protein yang dapat menghasilkan peptida bioaktif melalui hidrolisis enzimatis dengan enzim tripsin dan memiliki sifat sebagai peptida antibakteri terhadap E. coli. Penelitian ini bertujuan untuk mengidentifikasi urutan sekuen peptida dan memprediksi interaksi peptida fraksi hidrolisat susu kedelai dengan reseptor GyrB, PBP1b, dan PDF pada bakteri E. coli secara penambatan molekul. Penelitian ini dilakukan beberapa tahap yaitu hidrolisis, fraksinasi, analisis LC-HRMS dan penambatan molekul dengan HADDOCK 2.4. Fraksi peptida hasil hidrolisat menghasilkan kadar 35,857 ppm. Hasil penelitian menunjukkan bahwa urutan asam amino peptida yang dihasilkan yaitu IITSLGVK (P1) dan AKEMHIDAANTREYSIDHQSSNMDSDVAASHIDTV (P2). Hasil penambatan molekul peptida menunjukkan bahwa P1 membentuk pengikatan yang paling stabil dan spesifik dengan reseptor PBP1b dengan afinitas ikatan -11,0 kkal/mol dan membentuk interaksi spesifik pada residu asam amino Asn574, Asn703, Ala613, Ser507, Gly612, Ala608, Trp548, dan Asn615 sebagai ikatan hidrogen serta pada asam amino Lys553, Thr702, Ser510, Gln551, Pro550, Leu611, Thr701, Ser549, Gly509, dan Val706 sebagai interaksi hidrofobik. Adapun P2 membentuk pengikatan yang paling stabil dan spesifik dengan reseptor PDF dengan afinitas ikatan -9,4 kkal/mol dan membentuk interaksi spesifik pada residu asam amino Glu87, Glu95, Arg97, Glu41, Asp123, Leu125, dan Lys165 sebagai ikatan hidrogen serta Ile86, Ile44, Gly43, Glu42, Gly89, Cys90, Glu88, Leu91, Glu64, Ile128, Val62, Arg66, Asp162, dan Leu164 sebagai interaksi hidrofobik. |
| Abtrak (Bhs. Inggris) | Drug resistance is one of the biggest health threats in the 21st century, one of which is Antimicrobial Resistance (AMR). Continuous use of antibiotics can reduce mortality and morbidity in patients, so it is necessary to explore antibiotics from natural sources. Soybeans are a source of protein that can produce bioactive peptides through enzymatic hydrolysis with the enzyme trypsin and have properties as antibacterial peptides against E. coli. . This study aims to identify peptide sequences and predict the interaction of soy milk hydrolysate fraction peptides with GyrB, PBP1b, and PDF receptors in E. coli bacteria by molecular docking. This research was carried out in several stages, namely hydrolysis, fractionation, LC-HRMS analysis and molecular docking with HADDOCK 2.4. The results showed that the amino acid sequences of the peptides produced were IITSLGVK (P1) and AKEMHIDAANTREYSIDHQSSNMDSDVAASHIDTV (P2). The peptide molecule docking results show that P1 forms the most stable and specific binding with the PBP1b receptor with a binding affinity of -11.0 kcal/mol and forms specific interactions at amino acid residues Asn574, Asn703, Ala613, Ser507, Gly612, Ala608, Trp548, and Asn615 as a hydrogen bond as well as to the amino acids Lys553, Thr702, Ser510, Gln551, Pro550, Leu611, Thr701, Ser549, Gly509, and Val706 as hydrophobic interactions. Meanwhile, P2 forms the most stable and specific binding with the PDF receptor with a binding affinity of -9.4 kcal/mol and forms specific interactions at the amino acid residues Glu87, Glu95, Arg97, Glu41, Asp123, Leu125, and Lys165 as hydrogen bonds and Ile86, Ile44, Gly43, Glu42, Gly89, Cys90, Glu88, Leu91, Glu64, Ile128, Val62, Arg66, Asp162, and Leu164 as hydrophobic interactions. |
| Kata kunci | antibakteri, HADDOCK 2.4, penambatan molekul, peptida, susu kedelai |
| Pembimbing 1 | Dr. Dian Riana Ningsih, S.Si., M.Si. |
| Pembimbing 2 | Dr. Ely Setiawan, S.Si., M.Si. |
| Pembimbing 3 | |
| Tahun | 2025 |
| Jumlah Halaman | 101 |
| Tgl. Entri | 2025-02-24 10:59:05.170256 |
|---|